We're curious about: GREENJOBS
Looking for Accurate Weather Forecasts? Click here.

Idea: highest converting - mr universe's ultimate training system

http:// sbowker .az.com

AZ.COM AZ Zorgium: The owner of the unique content which we abstracted has a web page that our search engine cached here. For your convenience, our search engine enhancement has rendered it script and pop-up free. Proceed from our abstracted version to the owner's website in our frame page when you have determined you have further interest. We've included a hyperlink above in blue that will take you to the original fully formatted article and sources when clicked. We've also included hyperlinks to alternatives below in blue. AZ.COM AZ Zorgium provides endorsement free abstractions. BEWARE of 'fakeosphere'
fake articles, fake blogs (flogs) and web traps.

These following stats are for our tracking and internal use only:
SiteClicks: 75%, SegmentsViewed: 89%, Weight: 83%
ForwardChainedVisitors: 86%, LinkBacks: 66%, VerControl: 1.17

IDEA Alternates: pinnacle71 sannad345 newconcept surfedia musemrkt tmp777 leadschl syofb rsspower jorrie ultramkt1 removeirr acimastery clickfws legster alterna1 jimidurso informko onlinedocu essentialt apsystem mnm786 hooke1 chadconnec bedbugs11 mampie
IDEA Favorites: azcrazycbcashaz azemedia123az twominutesermon oatadil az-onepinky-az az-masterss-az az-twomasters-az az-107mcblois-az azfastestwaytogetstartedonlineaz az-stepbystepaffiliatemarketingsystem-az azsysenegaz az-dttiempo-az

Abstract

Simon Cohen's Ultimate Training System Cohen leaves behind his 140
pound skinny body to
break out and break records

"37 Year-Old Mr Universe Proves

You can Gain 12 Pounds of

Lean Muscle...and Carve out a Ripped

6-Pack in just 6 weeks"

"You Too Can Discover my Unique, No-Nonsense Bodybuilding Methods to
FINALLY Pack on Slabs of Rock Hard Muscle and Leave the Skinny Guy
Behind"

IFBB British Heavyweight Champion and 2 x winner of Mr Universe
reveal's how he went from skinny kid to 294 pound pure muscle
machine...

FREE VIDEO!

Get your copy of Mr Universe, Simon Cohen's interview.

Your Name : ______________
Your E-Mail : ______________

Get More Info!

Your email will be kept in the strictest confidence (no spam - ever!)

Dear Friend in Fitness,

Forget everything you've been told about body building and dieting
because...

...they're all lies!!!

The fitness industry has been lying to you...and I'm here to finally
expose the truth!

"So...Who am I, and Why Listen to Me...?"

My name is Simon Cohen, and I'm a Pro Body Builder having earned my Pro
card in 2001 at IFBB British Heavyweight Championship. My main titles
won are:

1996, 1997 - Mr Great Britain

1998 - Mr World

1998, 1999 - Mr Universe

I've spent the last 14 years training, using myself as a guinea pig, to
devise my Ultimate Training System the best secret muscle building and
fat loss systems out there....

...and then revealing these systems to the average struggling skinny
guy like yourself, so you can actually apply these unique fat loss and
secret muscle building strategies...and do the same.

So...if you're always looking for new ways to pack on as much muscle as
possible, here's why you should listen to me.

I'm the skinny guy, like you, who went from 140 pounds to a solid,
ripped muscle machine who won Mr Universe twice!

I got all the trappings of success as a world-class bodybuilder...the
fame, the glory, even a much coveted interview by FLEX magazine...

But you know what...?

I came so very close to meeting with disaster. It almost didn't
happen!

Let me explain...
"But Before I Tell you More, I
want to Share a Shocking True Story that Nearly Destroyed me..."

This story has a happy ending, but it was a close call.

Whilst putting the final touches to my 21 stone ripped mind blowing
physique for the IFBB British Championships, the unimaginable
happened...as I went down for my fourth rep on a 650 pound hack
squat... I heard this almighty tear and was hit with the most extreme
pain.

I knew my knee had gone...not only had I snapped a tendon below my
right knee, but I'd also dislocated it on the way down!

My biggest setback ever...

My dreams ruined...

My career in tatters...

I had to have two operations and was in plaster for 5 months...

What's worse, I was unable to train my legs for a year - years of hard
work and sweat down the drain!

The surgeons did such a great job, repairing the tendon soon after the
injury so that the healing time was much quicker and I could get back
to my new top secret hard core Ultimate Training System...which
produced results that I had never seen before.

You heard right: My legs are now better than ever before!

The secret Ultimate Training System was a godsend.

Can you imagine? Everybody said that my career was over but here I am
guys, I've proved you all wrong.

"Now...Stop Wasting your Last

Ounce of Energy

on Useless, Outdated Work-Out

Techniques that Leave you

Wanting"

I'm going to hand you the most powerful, Body Building system ever
developed for the average, "skinny guy."

It's the same system that I used to free myself forever from the
"skinny guy" image forever!

"I hated being the skinny one, and I really wanted to break away from
the years of frustration as a light weight weakling. I tried eating
more and working out, but I didn't gain a single ounce.

I wish I had this information when I first started out, as I would have
saved tons of money and effort on all of the B.S. programs that I was
following at the time.

My first workouts took place in my room with a small dumbbell set.
Biceps and abs seemed most important at the time. I was twelve years
old and inspired by Rich Gaspari, Berry DeMey and Dorian Yates. A
Dorian Yates poster had me crunching and curling on a daily basis.

After months of begging my reluctant parents finally gave in and paid
for my first ever gym membership which, thanks to the inside,
confidential sources I was privy to enabled me to follow the training
programmes which ultimately lead to my secret training system. Thanks
Mom!

It wasn't until 1994 that I started training, and eating like a
bodybuilder, being influenced by Dorian Yates' method of training,
using all basic heavy movements, they're the best for muscle growth and
give your body a real dense look.

I finally realized that I needed to transform my entire physique and it
was going to be a long hard slog and one of the most intense workouts
ever.

Most of all, it has made me believe in myself - you can achieve
anything if you set your mind to it!

As a matter of fact, so can you...

Better still, take just 5 minutes to read this page, and I'll reveal a
little-known way that you can easily gain more lean muscle mass, lose
stubborn fat and get ripped with one of the most revolutionary training
systems ever!

"Gain Weight Fast,

get Ripped

and Completely Jacked"

Okay, now you know about my background and, let's find out a little bit
more about you:

Are you frustrated `to death' with not being able to gain weight
despite years of trying?

Tired of battling that stubborn belly fat?

Do you want a REAL Body Building system that actually works and
generates results...WITHOUT having to have the "right genes" or having
to spend countless hours every day in the gym.

Are you fed up with all the conflicting advice from the so-called Body
Building `Pro's'?

If you answered YES to at least one of those questions, you really need
my help. And you need it NOW.

Before
After

"I'll Never Need Another Training Book or Magazine"

"By following the principles in Ultimate Training System I've lost 70
pounds and can finally see my abs. The information in Ultimate Training
System is so comprehensive that I won't ever need another training
magazine or book." Sean B

-

"Thought You had Found Everything

That Could Have Ever Been

Written About Explosive

Muscle Gains?"

Hacked off...?

... with the "Fitness Experts" Who Earn Fortunes from The Sweat And
Dreams Of Young Men & Women like you who are desperate to lose the
extra belly fat.

...with the supplement companies who are getting away with murder by
lying to you, ripping you off with bogus promises while people get
jacked around you!

...with corrupt marketing vultures that are getting rich by preying on
your fears, hopes and aspirations!

...with busting your ass trying to build muscle on those B.S. programs!

"I Used to be the Same, But

Then I Changed my

Life...Forever!"

And as you read each and every word of this page, you too will discover
how the lies the Fitness Industry has been selling you has kept you
from achieving the muscle growth and fat loss you've always dreamed
of...

"And you know what...?

They're Doing It On Purpose!" They don't want you to know the truth.

But that's all about to change. Yup!

Why?

Because I'm going to share with you my 14 years of experience, that
will ensure you build slabs of lean muscle, crank up your metabolism
and turn your body into a food-incinerating, fat-melting human furnace!

So...I want you to sit back and relax. Go get a cup of coffee and brace
yourself to hear this: get on the edge of your seat because...

"It's your Turn...Don't Waste

any More Time Making Mistakes with

Old Suicide Training Techniques"

Of course, body-building isn't an easy "walk-in-the-park" type program.
It's tough and challenging. Trainers are now paying attention, wanting
to know the recipe of my success (that is, until they hear it's not
just popping a pill and keep eating junk while sitting on the couch).

If you want to build muscle as quickly as possible, you NEED to know
the training, nutrition and supplementation techniques that will get
you the best results for your time and effort.

People were floored. They couldn't believe it really CAN be that easy.

-

"For the Skinny Guy, One of the
Biggest Hurdles in Getting Bigger
Is Not Having a Game Plan"
Over the last 14 years I've dedicated myself to studying and
understanding the hardest sport out there? It follows you around the
clock.

It separates and puts you above all others physically and mentally.
Those who have been bitten by a bug and know there's no end.

It's taking your body you're given to its epitome.

It's demanding but every bit as rewarding.

It's a lifestyle.

It's a constant climb.

It's fun as hell.

If you happen to be struggling to bulk up, or even lose fat, stick with
me for a few minutes and you'll see how this will work for you, like
never before!

But before I begin, there is one truth we have to establish right
now...
"They Won't Let Us Have the Answers!
A Training System so Powerful...
The Fitness Industry Want To
Keep it All For Themselves!"

Like it or not, our muscle gain and weight loss is controlled by a vast
multi-billion pound Fitness industry which will go to any lengths to
protect its vested interest.

Sure, they'll turn a blind eye to certain supplements that you can buy
over the counter, but mention the words "long term weight loss" or
"Ultimate Training System" and you'd better watch out. They'll come
down on you like a ton of bricks and put you out of business...

For instance, NOTHING brings out the rage and contempt of the
multi-billion pound Fitness Industry like a stealth training system
aimed at skinny guys like us.

They'll do anything - ANYTHING - whatever it takes to discredit us and
get our training systems banned!
"Scammed Out of Muscle Growth
by the Fitness Industry?"
What's more, it's easy to do. To the "fitness police", attacking secret
training systems is like taking candy from a baby.

So why the hysteria? Well, the simple fact that these multi-billion
pound Industry executives can't make profits from us. And if they can't
make profits, then they begin to lose their monopoly of the Fitness
Industry.

Not only is the Fitness Industry scamming you out of your cash, they're
scamming you out of Muscle growth that you could be building if you
only knew exactly what to do and how to do it...

I'm going to expose the dirty little secrets of the Fitness industry.

That's right, because their `advice' has been the NUMBER ONE factor
responsible for your failure to build muscle until now. THEY are the
reason you're still struggling right now.

Want to stop struggling? Want to move on? Want to get ripped?... here's
what to do:

-

"You Are About To Own a Killer Step-by-Step Body Building System
Exclusively Designed For Any Average Person With Little or No Fitness
Knowledge Who Has Tried Everything Else and Still Can't Build Quality
Muscle and Lose Fat"

My Ultimate Training System contains everything you will ever want to
know about how to build lean muscle and lose ugly belly fat. Here are
some secret tips and tricks you'll discover in my program:

� My secret "under-ground" techniques and ultimate dietary
strategies that carve out a ripped 6 pack - make the most of my stealth
weight training programmes - Ultimate Training System contains
everything you will ever want to know about how to build lean muscle
and lose fat.

� Discover the most important muscle building principle you can't
grow without - the absolutely necessary anabolic secrets for crazy
hyper-drive muscle gain and crazy-fast recovery time between workouts.

� Optimize the body's muscle growth and powerful fat burning hormones
the natural way -revving up your metabolism so that you can more easily
scorch away body fat while optimizing muscle growth.

� My unique Secret-Weapon exercise's that build a rock-hard core and
stimulate fat loss like no other exercises in existence... and the
kicker is that almost NOBODY in normal gyms knows about these unique
exercises. My special fat melting workout that actually helps you build
muscle while getting shredded to the bone and saving time

� Why crunches and sit ups are the worst things you could ever do
if you want to build a ripped, muscular six pack.

� Discover how to dramatically increase your muscle mass and strength
in the shortest amount of time
possible - by focusing on one basic scientific law of muscle-growth,
the absolute cornerstone for any effective muscle-building program.

� Keep yourself interested and motivated in your training, while
everyone else is wondering why their body looks the same or worse than
they did last year.

It cuts right through all of the useless hype and provides a detailed,
highly effective muscle building system that is laid out in a simple
step-by-step format that promises significant, measurable, explosive
gains in lean muscle mass even if you've been told you don't have the
"right genes" for bodybuilding...

Here's what some of the guys had to say:

Before
After

"This is Unreal!"

"50 pounds lighter and a 20 inch waist after following the Ultimate
Training System. I entered my first Figure Competition in September and
won! Thanks Simon." Carrie C

All you need to do....is:

"Follow My Highly Effective Muscle-Building Prescription that is
On-Target for Quick and Massive Muscle-Building Results"

My ultimate, no-nonsense Bodybuilding methods promise to finally
transform your body from skinny to ripped, packing on slabs of rock
hard muscle and leaving that skinny guy we all hate behind once and for
all.

Using one of the most intense workouts ever, I'll show you how to
ignore the lies of the Industry and break through any mass building
plateau to achieve the body you've always dreamed of.

And by mastering a few of my secret "under-ground" techniques, which
will make you bigger, stronger and ripped, you will maximize the muscle
growth and fat loss quickly and easily and beat Body Building Industry
at their own game.

-

"...My Revolutionary New System Will Transform Anyone's Physique...From
the Raw Beginner to the Seasoned Veteran and Even the Experienced
Fitness Coach"

Okay, check this out:

Imagine if I could prove to you that right now, a few smart Skinny guys
are on the brink of the GREATEST BODY BUILDING DISCOVERY in recent
history!

It's based on a few key insights - which I'll explain to you in a
minute. But first I want to tell you what's at stake...

The absolutely necessary anabolic secrets for crazy amounts of muscle
gain and recovery ability ensuring you build muscle and lose fat as
fast as possible.

Maximize the top little known anabolic secrets for hyper-drive muscle
gain. Every single one of these principles MUST be executed to build
even one pound of muscle.

You will not casually discover these rules on any website or in any
fitness magazine. Once you learn to exploit each one consistently,
your growth and fat loss will explode!

Bodybuilders at your gym will be coming to YOU for advice! You're no
longer on the outside looking in. Use these sneaky insider tricks to
ensure crazy-fast recovery time between workouts.

If you don't give your body a chance to properly recuperate between
workouts you will be pushing yourself farther away from your goals
rather than closer to them.

But what's the fastest and best way to do it? You've got to read the
book!

"Immediate Results"

"Immediate results are a big selling point of the Ultimate Training
system."

B Stevenson

"Athletic Muscle Building Delivers Results"

"I really enjoyed the workouts, but I don't do it for fun, I do it for
results. The Athletic Muscle Building program delivers results. Well
worth the investment."

Chris B

"I Am Really Impressed"

"I am really impressed with how much muscle I was able to put on so
quickly. The personal trainers I've worked with didn't help much and
cost at least 10 times as much as this system."

EK Sanders

"You'll find Everything
You Need To Know...How I Discovered a
Way to Gain Muscle Mass and
Shed Stubborn Fat...Fast..."

You don't need to know a single thing about Body Building to gain
muscle mass from this. This system works for anyone...even those who've
never lifted a weight before.

No gruelling hard work or insane back-breaking exercises are required
from you - ever. This is a `follow-the-directions' way of getting into
shape.

Once you're up to speed this will take no more than 30 minutes each
day. This has got nothing to do with complicated systems...Once you get
this down pat, 30 minutes a day MAXIMUM is all you'll need.

You WON'T have to bury yourself in complex training manuals before you
start. The beauty of this system is its simplicity. It could start
gaining muscle mass within hours!

-

"100% Success in Gaining Pounds
of Lean Muscle Mass Without Pumping
Yourself Full of Dangerous Drugs"

What's more, the market is wide open, yet most people - including a lot
of the big Body building "pro's" - still haven't realized how easy and
quick this is!

Well, that's their loss and your gain, literally! Read on and I'll show
you how you can gain muscle to leave that skinny body behind!

If you want to join the small but impressive group of Body Builders who
are showing the "Guru's" how it's done...

Then you need to stop learning from those Fitness Industry execs...
Stop buying into their `hype' and empty promises... Let me show you
what you'll learn...

� EXACTLY how to pair your muscles like a Pro - how many sets, reps
and how much weight and rest. And most importantly... how fast to move
the weight and when to change the program.

� Why doing certain abs exercises do NOT burn fat away from your
stomach and love handles... Instead, discover these unique exercises
that accomplish this MUCH more effectively!

� Exploit the BEST training techniques I have ever discovered - my
most intense workouts ever providing detailed, highly effective muscle
building systems that are laid out in a simple step-by-step format. -
This is the foundation of the entire program and will lead to your
GREATEST and QUICKEST muscular gains ever!

� Why fad diets may actually HINDER your efforts for a lean ripped
body... They can actually harm the hormonal balance in your body and
program your body to store fat in the long run!

� Learn the truth behind the bodybuilding myths and workout volume -
the nasty little secret about workout volume the "pros" never tell
you... and how ignoring this commonly accepted "truth" will not only
save you time and effort, but will also dramatically increase your
muscle gains beyond anything you've ever experienced.

� The number one fat burning principle - a unique nutrition trick that
tells your body that you're NOT starving so that it WON'T lower your
metabolic rate ensuring you get huge and ripped.

� How much and how little to train - how short your workout should
really be. Doing just a few extra minutes can kill your chances of
monster growth... no matter what you've heard in the past... Human
biology dictates exactly how long your routine should last.

� Ultimate dietary strategies that carve out ripped 6 pack abs -
little-known secrets for cranking up your metabolism and turn your body
into a food-incinerating, fat-melting human furnace.

Stop this never-ending cycle of falling for the same old nonsense
promises and lies, then getting annoyed at yourself when it doesn't
work out for you!

-

"Now You Can Finally be
Exposed to the Truth About
Building Lean Muscle Mass
and Melting Stubborn Belly Fat!"

Let's check out some of the myths that have been holding you back from
reaching your goals...

Myth#1 - "Supplements Can Replace a Good Diet"

Truth - No, they most certainly cannot. So many people believe this
myth, especially the beginners. I too, believed in this popular myth so
I am not one to criticize. Your diet is the base of foundation for your
progress. Lean Meat, Fruits and Whole Grains should be the base of your
diet. In my guide I'll show you a top secret method of combing these
food groups for mid blowing muscle gain

Myth#2 - "Light Weights & High Reps Increase Muscular Definition"

Truth - Not necessarily - Performing high repetitions with light
weights increases muscular endurance, but does not increase muscular
definition. Following a healthy nutrition plan and performing
cardiovascular exercise increases muscular definition. In my guide I'll
show you how to exploit my ultimate training techniques to gain
incredible muscle definition.

Myth#3 - "More Training Always Equals More Muscle"

Truth - No - Working out each muscle group too many times a week can
lead to overtraining and a loss in muscle. If you are in an
overtraining state, you must allow your body to recover for quite some
time before getting back to regular training, in order for body to
fully recuperate and get back to normal. In my Ultimate Training System
I'll show you just how much or how little to train to achieve your gao

Myth#4 - "You don't have to be strong to be big"

Truth - No - For a variety of reasons, people, even those with an equal
amount of muscle mass, vary in strength enormously. It might have
something to do with fast-twitch/slow-twitch muscle ratios, or it might
have something to do with the efficiency of nerve pathways or even limb
length and the resultant torque.
Myth#5 - "Training with weights causes your muscles to get tight and
hinders flexibility and, consequently, athletic performance" Truth - No
- If anything, when done properly (slowly and using a complete range of
motion), weight training increases flexibility. In my guide I'll show
you exact training techniques and the correct way to execute them.

Myth#6 -"You need high reps for definition and low reps for mass"
Truth - No - A muscle can only do one of three things. It can get
bigger, it can get smaller, or it can stay the same size. The way to
make a muscle bigger is to subject it to a progressive intensity of
overload. That is, the intensity of today's workout needs to be a
little higher than your last workout for that muscle. My Ultimate
Training System will show you how to pair your muscles like a pro and
ensure huge amounts of lean muscle growth.

-

"All the Answers
You Have Been Looking For"

The Guru's really have got it all wrong. These myths are holding
thousands of hardworking skinny guys back from reaching their
goals...the only people who know the real truth are the Body Building
"Pro's"

But don't get me wrong: There are a probably a handful of Body Builders
out there using the right training methods. But I can almost guarantee
you they're not doing it quite as easily (or confidently) as I am, but
more on that in a minute...

But regardless of how you've been trying to train, how's it going?

If you're like most people I've met, you're probably about ready to
pull your hair out... Most people just about kill themselves trying to
find the "secret formula" for making this as easy as the gurus say it
should be.

And when I say most people, I'm not making that up.

"One of the Most Complete
Muscle-Building Resources Ever!"

Here's a little taste of what I'm going to provide you, which I
guarantee will take you from the skinny little guy to the pumped up guy
by building crazy amounts of muscle using my revolutionary training
system.

� How to maximize your Muscle Building Nutrition - which supplements
actually work and which are total junk. Stop getting scammed and
unearth the insider secrets about supplements.

� Exploit my ultimate training techniques -... this is about giving
you the full head-turning package... muscular biceps, wide shoulders,
horseshoe triceps, chiselled pecs, rock hard legs, and of course...
carved out abs.

� The top secret muscle building ingredient - add inches to your
frame - detailed descriptions and photos of the most effective
exercises in existence that will give you a rock hard body from head to
toe! Choose the most EFFECTIVE exercises to add inches to your frame.

� Inside information into which popular supplements should be avoided
like the plague - discover the hidden rules of the supplement industry
- not only are you being ripped off but you are jeopardizing your
strength gains and being made a fool of.

� Truth about Building Lean Muscle Mass - discover the most important
muscle building principle you can't grow without.

� A sneaky trick to break through any mass building plateau' for ever
- learn this key ingredient and never experience another frustrating
muscle building plateau again.

� Discover the number 1 principle associated with fat burning - it's
not as complicated as the nutrition experts would like you think

� Little know techniques that allow you to strip away body fat - REAL
exercises that burn 3-4 times more calories and therefore more fat in
the same amount of time!

� Cutting-edge designed full-body training PROGRAMS that will set you
on the correct path to a body of stone.

� My ultimate diet rules - fat-triggering foods that destroy your
efforts, become an expert on which foods to eat to enhance your body's
levels of important anabolic hormones. My diet shows you exactly how to
eat to optimize your body's natural muscle-increasing hormones. Learn
how the real experts do it.

� My secret's on work split and rest intervals - the perfect workout
split that will build muscle rapidly in even the skinniest of hard
gainers.

� The truth about training to failure - Is it really necessary to go
to failure, or are you actually digging your own grave?

� Lower abs vs. upper abs training - change your training technique
and watch that lower belly fat start to disappear!

� Specialization Training On Lagging Body Parts - how the heck are you
going to build your chest, back, shoulders and legs if your smaller
muscle groups are lagging?

� The number one most important principle of building muscle that is
actually overlooked in 99% of all workout programs.

� Learn the secret to structuring the most effective weightlifting
routines possible by spending no more than 2 hours and 45 minutes in
the gym per week.

� The Truth About the optimum amount of protein you need to gain
muscle mass? - this is scientifically proven to be the maximum amount
needed.

� What unique chest exercises are actually 200% more effective than
the bench press when it comes to building massive pecs.

� How to avoid unwanted fat gain and actually get enormously huge while
still maintaining a ripped set of six pack abs.

� And much more...

-

"Wow! This Sounds Great, Simon!
How Much Does It Cost?"

How much?

I bet you're extremely worried about the price tag ...

I'm sure you've noticed several training systems that make hollow
promises with large price tags!

The Ultimate Training System is actually really inexpensive when you
consider what you're getting here and how in the past you've been
scammed and wasted your hard-earned money on personal training,
exercise machines, diet pills, gym memberships, supplements and
gimmicks.

I've literally spent hundreds of hours and thousands of dollars
perfecting these methods, and putting them all in one easy-to-follow
video program for you, all this is available to you for half the price
you would pay for a month's supply of one of those supposed miracle
"extreme fat loss pills" or faddy gimmicks.

You probably could figure these things out on your own, but only if
you're willing to invest years of your life and a lot of money to do
so. I learned these strategies the hard way, through trial and error
and using myself as the guinea pig, but you don't have to. This program
will literally shave years off your learning curve, and have you
building the kind of ripped body you've always wanted.

So how much?

In fact, when you think about it...

"It Really Boils Down To Just
13 Cents Per Day!"

Let me ask you something...

What else do you spend 13 cents per day on that makes a massive
difference to your life?

Most people happily spend $5-$10 a day on expensive coffee drinks, and
they have nothing to show for it at the end of the day. But for only 13
cents a day, you can get the little-known workout tricks and nutrition
tactics that took me years to acquire.

Isn't your future health worth investing this small amount in? I've
made this programme inexpensive enough so that anyone who is serious
about losing their hideous belly fat or packing on solid rock hard
muscle can afford it.

So...seriously, if you don't take action... you'll simply continue to
struggle for years more with those flabby abs and extra belly fat.

Why not make the decision TODAY to finally learn an exact proven method
of success to eat and train that will actually allow you to strip away
your stubborn stomach fat to reveal those elusive chiselled abs that
everybody wants, but so few know how to get!

Alright, I want to take any doubts or indecision you might have at this
point, out of your head. You'll just keep procrastinating and making up
lame excuses as to why you're "gonna wait until next week" to start
working out and eating right.

Before we get to that, here's what else is included in the package:

Ultimate Training System

This is the instantly downloadable 108 page e-book that provides you
with Simon Cohen's unique no-nonsense bodybuilding methods. It's all
you need to pack on slabs of lean muscle and carve out a ripped 6 pack.

Simon, 2 x former Mr Universe and an IFBB pro bodybuilder
finally shares the secrets of the pros that will help transform the
average skinny guy out there.

Six weeks to a ripped six pack...believe it or not, but yes it is
possible!

The Ultimate Training System is the best secret muscle building and fat
loss system out there. It contains all you'll ever need to get the body
you truly deserve.

Thought you had read everything that could have been written about
explosive muscle gains? Think again...finally the BS comes to an end
and all that has been hidden from us by the fitness industry is finally
revealed.

You to can change your life forever!

Free Bonus No.1 #

Best 15 minute workouts

Get access to the best 15 min workouts on the market today.

Covering everything from warm up's to burning the unsightly belly
fat we're all so desperate to shift. Hectic day...short on
time...Simon's 15min workouts are perfect, ensuring you still get
the burn.

Includes full exercise descriptions and much much more...

Free Bonus No.2 #

Top Abs Tips And Exercises

This is the information no one wants to hear or read because
it means responsibility and dedication, not magic potions or god-sent
gizmos.

There is some good news though...

Included is a multitude of information all of which will help you carve
out that six pack you desire.

You have the opportunity right here in front of you put things right
and discover tried and tested programs that will help you rid stubborn
body fat permanently, increase lean muscle tone and define a firmer,
flatter stomach.

Stop the frustration, and FINALLY ignite your metabolism and fire up
your own body's fat-burning hormones to strip off that ugly belly fat
and uncover those sexy six pack abs that will have heads turning your
way!

Free Bonus No.3 #

Personal Metabolic Rate Calculator

This calculator will approximate how many calories your body needs
daily to maintain the same weight.

In addition, calculations are provided that approximate how many
calories per day you would need to consume to either lose weight or
gain weight depending on your ultimate goals.

Simply enter your information and everything's calculated for you.

Free Bonus No.4 #

Nutrition - Eat Like A Superhero

Eat properly and become the ultimate superhero. The complete
breakdown on the good and the bad.

These guides combine the very best sources of protein, carbs and fats
that will make up meals plans that are delicious, simple, and varied,
not bland and boring.

Did you know that Proper Nutrition accounts for as much as 80% of the
equation when sculpting a six-pack and creating a leaner physique? In
fact, eating correctly will actually supercharge your metabolism which
will burn fat like you never thought possible!
You will learn what, when and how to eat, control cravings and increase
your metabolism, so that you can burn fat not just when you're
exercising, but throughout the day too. In no time you'll be eating
smarter and looking leaner!

My Guarantee

100% Unconditional 60 Day Money Back Guarantee

I'm so confident that my Ultimate Training System will work
for you, that I've put ALL of the risk in my hands. This covers you if
you decide at any time that the Program is not working for
you. Although, the program WILL work for you if you apply the
techniques.

That's no questions asked for a full 60 days!

Believe it or not, you can get your hands on these unique dietary
strategies and secret training techniques for only [DEL: $67 $47 :DEL]
$39.95. That's less than the cost of an average annual gym membership
at $375 or a one off personal training session with a top notch trainer
at $80. Remember this is going to be the ONLY clear cut training
program you will EVER NEED to improve your body.

Be honest, are you working towards the body you deserve?

Just take a moment to ask yourself: what you would do if you were to be
in my shoes right now? Would you do things which you previously thought
impossible for you to do?

The main benefit you derive from my Ultimate Training System is to
finally get the body you have always dreamt of and deserve...yes, it is
possible! Imagine that the only limitations being your own imagination
and belief. I'm here to tell you that this could be your reality in as
little as a few weeks from now - but only if you break away from the
old paradigms of failure once and for all, and embark on a radically
different and exciting path today. It is entirely possible, but to do
so, you must be prepared to cast off the old training techniques and
admit you need something new, something different to make it all happen
and achieve your goals.

Most importantly, think what that new body means to YOU - and whether
you are ever going to have the body you desire if you continue along
your current path.

You must be ready and willing to grasp the opportunity while it's still
here...and within easy reach...

-

"Everything you've ever needed

to get you into

mind blowing shape!"

Instant access to:

Ultimate Training System

Ultimate Training System

This is the instantly downloadable 108 page e-book that provides you
with 2 x Mr Universe's unique no-nonsense bodybuilding methods

Sells For: [DEL: $120 :DEL]

Free Bonus No.1 #

Free Bonus No.1 #

Best 15 minute workouts

Covering everything from warm up's to burning the unsightly belly fat
we're all so desperate to shift.

Sells For: [DEL: $110 :DEL]

Free Bonus No.2 #

Free Bonus No.2 #

Top Abs tips and Exercises

Included is a multitude of information all of which will help you carve
out that six pack you desire.

Sells For: [DEL: $120 :DEL]

Free Bonus No.3 #

Free Bonus No.3 #

Personal Metabolic Rate Calculator

Simply enter your information and everything's calculated for you.

Valued at: [DEL: $20 :DEL]

Free Bonus No.4 #

Free Bonus No.4 #

Nutrition - Eat like a Superhero

Eat properly and become the ultimate superhero. The complete breakdown
on the good and the bad.

Sells For: [DEL: $100 :DEL]

Total valued at $[DEL: 470 :DEL]

The good news is, I'm not going to charge you $470 for my Ultimate
Training System...All this on offer...as an introductory offer for
$[DEL: 250 :DEL] , $[DEL: 105 :DEL] , $[DEL: 77 :DEL] ...no, all this
for you for only $39.95.

Valued at [DEL: $470 :DEL]

Only $39.95

[DEL: :DEL]

[DEL: - :DEL]

[DEL: :DEL]

[DEL: :DEL]

"Okay Simon, I'm Convinced.

I Want This Ultimate Training System!

What do I do Now?"

It's easy to order. All you need to do is click the link below, which
will take you to the order page, and then you just enter your
information in. The whole process only takes a minute or two. As soon
as you place your order, you'll immediately be taken to a secret page
where you can download the Ultimate Training System and access the fat
loss secrets that no one else will tell you about.

There is no shipping and handling, because it's an electronic book.
That means you won't have to wait, no matter what your goals are, you
can start using this powerful system right now to get leaner than
you've ever been before.

Go ahead and click the order link below, and see what all the fuss is
about. You'll get instant access to the entire system and the
bonuses... even if it's 1 in the morning.

-

Simon Cohen

Pro Bodybuilder, IFBB British Heavyweight Champion, Mr Universe, Mr
World and Mr Britain

PS: My Ultimate Training System can work for you too, so don't delay
any longer! If you're tired of all the hype and b.s., if you're ready
for the truth, and if you're sincere about wanting to reach your goals,
then stop procrastinating and putting off your goals!

PPS: Right now, if you don't decide to take the first step towards a
better body, better health and a better you, then you're deciding to
keep looking and feeling the same as you've always been. Stop making
lame excuses.

PPPS: If you're even remotely interested in learning the truth about
permanent fat loss, then you owe it to yourself to at least try my
Ultimate Training System. Almost 90% of the people in this world are
going to keep looking for that magic pill or quick fix. But I don't
think you would have read this far if you were the type of person to
follow the crowd.

PPPPS: You have nothing to lose by at least trying my Ultimate Training
System...remember, you have my 100%, no questions asked, iron-clad
guarantee that protects your purchase, no matter what...so click on the
link below to order today!

-

� ULTIMATESIMONCOHEN.COM 2009-2011 ALL RIGHTS RESERVED | FAQ | CONTACT
US

End of Abstract

ZORGIUM NOTE TO CONTENT PROVIDERS: If you end up experiencing long delays before the content of this page is indexed by your search engine, you may need to change search engines. Goto your browser's AZ toolbox and select option "YAHOO as Alternate", or "BING as Alternate." Yahoo usually indexes our pages the best, i.e., search for "az.com" using yahoo.com. If you don't want your page to appear in Zorgium's search abstraction then put an exclusion for "Zorgium" in your web server's robots.txt file.

DISCLAIMER: Zorgium is a free world-wide-web engine from AZ.COM. You may use it, but by doing so you agree that your use of other people's information discovered via our website is entirely your responsibility. Enjoy!
View Full Article